Loading...
Statistics
wedindie – You've Got This
www.wedindependent.com/
You've Got This
Wedindependent.com
Wedindependent.com is hosted in
United States
/
San Francisco
.
Wedindependent.com uses HTTPS protocol.
Number of used technologies:
9.
First technologies:
CSS, Google Font API, Gravatar,
Number of used javascripts: 7.
First javascripts:
Gprofiles.js, Wpgroho.js, Jquery.autoresize.js,
Number of used analytics tools:
1.
First analytics tools:
ComScore,
Its server type is:
nginx.
Its CMS is:
Wordpress.
Technologies in use by Wedindependent.com
Technology
Number of occurences: 9
- CSS
- Google Font API
- Gravatar
- Html
- Html5
- Javascript
- Php
- Pingback
- Shortcodes
Advertisement
Javascripts
Number of occurences: 7
- gprofiles.js
- wpgroho.js
- jquery.autoresize.js
- script.js
- widgets.js
- 725X1342.skimlinks.js
- w.js
Content Management System
Number of occurences: 1
- Wordpress
Analytics
Number of occurences: 1
- comScore
Advertise
Number of occurences: 1
- Skimlinks
Server Type
- nginx
Social
Number of occurences: 1
- Twitter Button
Conversion rate optimization |
|
|---|---|
Clickable call number
|
Not founded! |
|
Conversion form (contact form, subcriber)
|
Founded! |
|
Clickable email
|
Not founded! |
|
CTA (call to action) button
|
Founded! |
|
List
|
Founded! |
|
Image
|
Not founded! |
|
Enhancement
|
Not founded! |
|
Responsive website
|
Founded! |
|
Facebook sharing
|
Not founded! |
|
Google+ sharing
|
Not founded! |
|
Twitter sharing
|
Not founded! |
|
Linkedin sharing
|
Not founded! |
|
Blog on the webiste
|
Not founded! |
HTTPS (SSL) - Wedindependent.com
SSL certificate
- name: /CN=tls.automattic.com
- subject:
- CN: tls.automattic.com
- hash: 6338c477
- issuer:
- C: US
- O: Let's Encrypt
- CN: Let's Encrypt Authority X3
- version: 2
- serialNumber: 334601970365591484320680441873593189693055
- validFrom: 160404130800Z
- validTo: 160703130800Z
- validFrom_time_t: 1459775280
- validTo_time_t: 1467551280
- extensions:
- keyUsage: Digital Signature, Key Encipherment
- extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
- basicConstraints: CA:FALSE
- subjectKeyIdentifier: E8:85:FE:02:CB:07:18:96:64:2A:57:EE:71:A3:B5:2D:8D:BD:2E:88
- authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
- authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
- subjectAltName: DNS:tls.automattic.com, DNS:wedemandareferendum.net, DNS:wedemangallery.com, DNS:wedennials.com, DNS:wedesignyourresume.com, DNS:wedgehammer.com, DNS:wedgeheadevents.com, DNS:wedgeintheround.com, DNS:wedgiefoodie.com, DNS:wedgwood.io, DNS:wedgwoodinseattlehistory.com, DNS:wedham.com, DNS:wedindependent.com, DNS:wedindie.com, DNS:wedinlondon.com, DNS:wedinthesun.org, DNS:wedinvancouver.com, DNS:wedkarskiblog.com, DNS:wedmelove.com, DNS:wedmoon.com, DNS:wednesday-addams.com, DNS:wednesdayconfessions.com, DNS:wednesdaydevotional.com, DNS:wednesdaylens.com, DNS:wednesdaylupypciw.com, DNS:wednesdaymiddaymedley.org, DNS:wednesdaymissives.com, DNS:wednesdaymorningdevotional.com, DNS:wednesdaynightcubs.com, DNS:wednesdaynitelivepalmsprings.com, DNS:wednesdaysathome.com, DNS:wednesdayswithme.com, DNS:wednesdayswoefulchild.com, DNS:wednesdaywail.com, DNS:wednesdaywarriorgirl.com, DNS:wednesdaywonderings.com, DNS:wednesdaywriting.net, DNS:wedobsessed.com, DNS:wedonotneedkidsfullstop.net, DNS:wedontneedoil.com, DNS:wedontneedoil.org, DNS:wedontsitoncouches.com, DNS:wedostyle.co, DNS:wedprops.com, DNS:wedrankhere.com, DNS:wedreamofbetterthings.com, DNS:wedreamofnicecream.com, DNS:wedressyouup.org, DNS:wedstrijdvisser.com, DNS:wedtin.com, DNS:weeappetit.com
- certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/
Number of occurences: 10
- Name:
Content: en_US - Name: viewport
Content: width=device-width, initial-scale=1 - Name: generator
Content: WordPress.com - Name: twitter:site
Content: @wordpressdotcom - Name: application-name
Content: wedindie - Name: msapplication-window
Content: width=device-width;height=device-height - Name: msapplication-tooltip
Content: You've Got This - Name: msapplication-task
Content: name=WordPress.com Forums;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico - Name: title
Content: wedindie on WordPress.com - Name: description
Content: You've Got This
Server / Hosting
- IP: 192.0.78.24
- Latitude: 37.75
- Longitude: -122.42
- Country: United States
- City: San Francisco
Rname
- ns2.wordpress.com
- ns3.wordpress.com
- ns1.wordpress.com
Target
- hostmaster.wordpress.com
HTTP Header Response
HTTP/1.1 301 Moved Permanently
Server: nginx
Date: Thu, 14 Apr 2016 09:18:04 GMT
Content-Type: text/html
Content-Length: 178
Connection: keep-alive
Location: https://wedindependent.com/
X-ac: 3.ams _dca
HTTP/1.1 200 OK
Server: nginx
Date: Thu, 14 Apr 2016 09:18:04 GMT
Content-Type: text/html; charset=UTF-8
Connection: keep-alive
Vary: Accept-Encoding
Vary: Cookie
X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header.
Link: ; rel=shortlink
X-ac: 3.ams _dca
DNS
host: wedindependent.com
- class: IN
- ttl: 299
- type: A
- ip: 192.0.78.25
host: wedindependent.com
- class: IN
- ttl: 299
- type: A
- ip: 192.0.78.24
host: wedindependent.com
- class: IN
- ttl: 86400
- type: NS
- target: ns2.wordpress.com
host: wedindependent.com
- class: IN
- ttl: 86400
- type: NS
- target: ns3.wordpress.com
host: wedindependent.com
- class: IN
- ttl: 86400
- type: NS
- target: ns1.wordpress.com
host: wedindependent.com
- class: IN
- ttl: 86400
- type: SOA
- mname: ns1.wordpress.com
- rname: hostmaster.wordpress.com
- serial: 2005071858
- refresh: 14400
- retry: 7200
- expire: 604800
- minimum-ttl: 300
Common Typos/Mistakes
This list shows You some spelling mistakes at internet search for this domain.
www.edindependent.com, www.w edindependent.com, www. edindependent.com, www.wcedindependent.com, www.cedindependent.com, www.wedindependent.com, www.edindependent.com, www.wdedindependent.com, www.dedindependent.com, www.wfedindependent.com, www.fedindependent.com, www.wgedindependent.com, www.gedindependent.com, www.wbedindependent.com, www.bedindependent.com, www.wdindependent.com, www.wexdindependent.com, www.wxdindependent.com, www.wesdindependent.com, www.wsdindependent.com, www.wewdindependent.com, www.wwdindependent.com, www.werdindependent.com, www.wrdindependent.com, www.wefdindependent.com, www.wfdindependent.com, www.wevdindependent.com, www.wvdindependent.com, www.wecdindependent.com, www.wcdindependent.com, www.weqdindependent.com, www.wqdindependent.com, www.weadindependent.com, www.wadindependent.com, www.weydindependent.com, www.wydindependent.com, www.weindependent.com, www.wedtindependent.com, www.wetindependent.com, www.wedgindependent.com, www.wegindependent.com, www.wedbindependent.com, www.webindependent.com, www.wedxindependent.com, www.wexindependent.com, www.wedsindependent.com, www.wesindependent.com, www.wedfindependent.com, www.wefindependent.com, www.wedvindependent.com, www.wevindependent.com, www.wedyindependent.com, www.weyindependent.com, www.wedzindependent.com, www.wezindependent.com, www.wedaindependent.com, www.weaindependent.com, www.wedeindependent.com, www.weeindependent.com, www.wedrindependent.com, www.werindependent.com, www.wedndependent.com, www.wedirndependent.com, www.wedrndependent.com, www.wedifndependent.com, www.wedfndependent.com, www.wedivndependent.com, www.wedvndependent.com, www.wedikndependent.com, www.wedkndependent.com, www.wedi,ndependent.com, www.wed,ndependent.com, www.wedibndependent.com, www.wedbndependent.com, www.wedigndependent.com, www.wedgndependent.com, www.weditndependent.com, www.wedtndependent.com, www.wediyndependent.com, www.wedyndependent.com, www.wediundependent.com, www.wedundependent.com, www.wedijndependent.com, www.wedjndependent.com, www.wedimndependent.com, www.wedmndependent.com, www.wedinndependent.com, www.wednndependent.com, www.wedidependent.com, www.wedinndependent.com, www.wedindependent.com, www.wedinhdependent.com, www.wedihdependent.com, www.wedinjdependent.com, www.wedijdependent.com, www.wedinkdependent.com, www.wedikdependent.com, www.wedinldependent.com, www.wedildependent.com, www.wedin dependent.com, www.wedi dependent.com, www.wedinependent.com, www.wedindtependent.com, www.wedintependent.com, www.wedindgependent.com, www.wedingependent.com, www.wedindbependent.com, www.wedinbependent.com, www.wedindxependent.com, www.wedinxependent.com, www.wedindsependent.com, www.wedinsependent.com, www.wedindfependent.com, www.wedinfependent.com, www.wedindvependent.com, www.wedinvependent.com, www.wedindyependent.com, www.wedinyependent.com, www.wedindzependent.com, www.wedinzependent.com, www.wedindaependent.com, www.wedinaependent.com, www.wedindeependent.com, www.wedineependent.com, www.wedindrependent.com, www.wedinrependent.com, www.wedindpendent.com, www.wedindexpendent.com, www.wedindxpendent.com, www.wedindespendent.com, www.wedindspendent.com, www.wedindewpendent.com, www.wedindwpendent.com, www.wedinderpendent.com, www.wedindrpendent.com, www.wedindefpendent.com, www.wedindfpendent.com, www.wedindevpendent.com, www.wedindvpendent.com, www.wedindecpendent.com, www.wedindcpendent.com, www.wedindeqpendent.com, www.wedindqpendent.com, www.wedindeapendent.com, www.wedindapendent.com, www.wedindeypendent.com, www.wedindypendent.com, www.wedindeendent.com, www.wedindepiendent.com, www.wedindeiendent.com, www.wedindepkendent.com, www.wedindekendent.com, www.wedindepuendent.com, www.wedindeuendent.com, www.wedindepjendent.com, www.wedindejendent.com, www.wedindeplendent.com, www.wedindelendent.com, www.wedindepndent.com, www.wedindepexndent.com, www.wedindepxndent.com, www.wedindepesndent.com, www.wedindepsndent.com, www.wedindepewndent.com, www.wedindepwndent.com, www.wedindeperndent.com, www.wedindeprndent.com, www.wedindepefndent.com, www.wedindepfndent.com, www.wedindepevndent.com, www.wedindepvndent.com, www.wedindepecndent.com, www.wedindepcndent.com, www.wedindepeqndent.com, www.wedindepqndent.com, www.wedindepeandent.com, www.wedindepandent.com, www.wedindepeyndent.com, www.wedindepyndent.com,
Other websites we recently analyzed
- carbonnegativealliance.mobi
Scottsdale (United States) - 184.168.221.32
Server software: Microsoft-IIS/7.5
Technology: Html, Html5, Iframe - dplus.gif
Amsterdam (Netherlands) - 85.17.252.206
Server software: Apache/2.2.29 (Unix) mod_ssl/2.2.29 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
Technology: CSS, Html
Number of meta tags: 1 - Mijndomein
Netherlands - 37.16.0.143
Server software: Apache/2.4.10
Technology: BootstrapCDN, Maxcdn, CSS, Font Awesome, Html, Html5, SVG
Number of Javascript: 3
Number of meta tags: 5 - BookFactory® Lab Notebooks, Log Books and Engineering Notesbooks
Save money and time by ordering your laboratory notebooks, log books, blank books, journals and made-to-order books factory direct from BookFactory.Ashburn (United States) - 54.243.176.249
Server software: Apache/2.2.22 (Ubuntu)
Technology: CSS, Html, Javascript, Php, Google Analytics, Google +1 Button
Number of Javascript: 5
Number of meta tags: 5 - Amazing Vacation Rentals in Phuket, Thailand — Andaman Residences
Dublin (Ireland) - 54.217.250.217
Server software: nginx
Technology: BootstrapCDN, CSS, Font Awesome, Html, Html5, Javascript, jQuery
Number of Javascript: 3
Number of meta tags: 5 -
Home Search With Eden Ashburn
Search our comprehensive MLS listings database using our Home Search tool. Work with Eden Ashburn, a certified Lowell agent, today!United States - 162.245.53.30
Server software: Apache/2.2.15 (CentOS)
Technology: Carousel, CSS, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, jQuery Cookie, jQuery UI, Php, Pingback, Facebook Retargeting, Google Analytics, Wordpress, Facebook Box
Number of Javascript: 32
Number of meta tags: 5 - NTP
Kirkland (United States) - 69.64.156.73
Server software: nginx
Technology: CSS, Html, Iframe, Javascript, jQuery, Php, Swf Object
Number of Javascript: 9
Number of meta tags: 1 - Kezdőlap
Hungary - 195.228.135.162
Server software: Apache/2.4.7
Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery
Number of Javascript: 3
Number of meta tags: 3 - Kryogenesis
Dublin (Ireland) - 54.194.41.141
G Analytics ID: UA-68727005-1
Server software: nginx/1.10.0
Technology: CSS, Html, Iframe, Javascript, Facebook Retargeting, Google Analytics, Google Tagmanager, Pingdom, Facebook Box
Number of Javascript: 4
Number of meta tags: 7 - StellarNet Spectrometers Online Shop
Austin (United States) - 192.200.169.229
G Analytics ID: UA-647712-2
Server software:
Technology: CSS, Flexslider, Html, Javascript, jQuery, jQuery Bgiframe, jQuery Validate, jQuery UI, Php, SuperFish, Google Analytics
Number of Javascript: 21
Number of meta tags: 7